PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn212121
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 1052aa    MW: 113171 Da    PI: 6.1293
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn212121genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26053.95.1e-1798910453288
      DUF260   32 nvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqle 88  
                   vh++FGasnv+kll++lp  +r +a++++ yeA ar++dP+yG+v+ il+lqqq++
  Achn212121  989 GVHRVFGASNVSKLLSRLPVIDRGEAAATMSYEALARMEDPIYGCVAQILALQQQVS 1045
                  59*****************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF079901.4E-161250665IPR012940Nucleic acid binding NABP
PROSITE profilePS50303133.329646986IPR033133Pumilio homology domain
SuperFamilySSF483711.58E-118649983IPR016024Armadillo-type fold
Gene3DG3DSA:1.25.10.104.4E-139649989IPR011989Armadillo-like helical
CDDcd079202.36E-172662982IPR033712Pumilio, RNA binding domain
SMARTSM000252.3E-6666701IPR001313Pumilio RNA-binding repeat
PfamPF008067.0E-7666699IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030211.394666701IPR001313Pumilio RNA-binding repeat
PROSITE profilePS503029.947702737IPR001313Pumilio RNA-binding repeat
SMARTSM000251.7E-6702737IPR001313Pumilio RNA-binding repeat
PfamPF008063.7E-7705733IPR001313Pumilio RNA-binding repeat
SMARTSM000253.2E-7738773IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030210.857738773IPR001313Pumilio RNA-binding repeat
PfamPF008064.5E-6739770IPR001313Pumilio RNA-binding repeat
SMARTSM000254.0E-7774809IPR001313Pumilio RNA-binding repeat
PROSITE profilePS503027.521774797IPR001313Pumilio RNA-binding repeat
PfamPF008065.9E-6782808IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030211.044809845IPR001313Pumilio RNA-binding repeat
SMARTSM000251.2E-6810845IPR001313Pumilio RNA-binding repeat
PfamPF008062.5E-9813844IPR001313Pumilio RNA-binding repeat
SMARTSM000251.1E-5847882IPR001313Pumilio RNA-binding repeat
PROSITE profilePS5030212.047847883IPR001313Pumilio RNA-binding repeat
PfamPF008061.4E-6850878IPR001313Pumilio RNA-binding repeat
SMARTSM000255.3E-7883918IPR001313Pumilio RNA-binding repeat
PfamPF008064.7E-5883914IPR001313Pumilio RNA-binding repeat
PROSITE profilePS503027.544884918IPR001313Pumilio RNA-binding repeat
PROSITE profilePS503029.597919960IPR001313Pumilio RNA-binding repeat
SMARTSM000258.2E-7925960IPR001313Pumilio RNA-binding repeat
PfamPF008062.8E-7931959IPR001313Pumilio RNA-binding repeat
PROSITE profilePS508919.759451051IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-169881045IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1052 aa     Download sequence    Send to blast
MISDTGMRSV LQSSDYGEEL GLWQEASERE RELSRYRSGS APPTVEGSLS AVGGLFGGGS  60
GGVAADFVGV PEEEMRSDPA YVSYYYANVN LNPRLPPPLL SKEDWRYAQR LQGTGGGLGL  120
GGIGDGRKVS RGGEWGGDGL IGLSGLGLGS RKKSIAEIIQ DDISHATPVS RHPSRPASRN  180
AFNDGVESSE SHFAHLHHEL ASMDVLRSGA NIQGIPAAQS IGTSASHTYA SALAASLSRS  240
TTPDPQLVAR APSPHIPPVG VGRVSSMDKR NGNGSNSFNG VSPSMSEPAD LVAALSGMSL  300
STNGVVDEEN LARSVIQQEI DDHQDAFHLQ ADQNHIKQNP YINISESGKF HLHSASHGGV  360
EVDMNSSYLT ADGQVALHKP AVSSANSYLK GPPTPILNSG GSSASNYHNF GSPNSSFSNY  420
GFSGYAINPA SPTMMGNQTG NFPPLFENVV NASAMGVSGL DSRALGGGLA LGPNVMAVTA  480
ELQNFSRAGN HNAGSALQMP LMDPLYLQYL RTTEYAAAQA APFSDPTIDR EGIGNAYMDL  540
IGLQKAYLGS LHSPQKSQYG LPYLGKSGSL NHNYYGNPSF GLGINGMSYP GSPLAGPLLP  600
NSHIGSGSPV RHGERNMRFS SSLRNLAGGV MGSWQPEAGG SLDGHFASSL LDEFKSNKTR  660
CFELSEISGH VVEFSADQYG SRFIQQKLET ATTEEKNMVF HEIMPQALSL MTDVFGNYVI  720
QKFFEHGTAS QIGEMADQLT GHVLTLSLQM YGCRVIQKAI EVVDLDQQTR MVAELHGNVM  780
RCVRDQNGNH VIQKCIECIP QEAIEFIISV FYDQVVTLST HPYGCRVIQR VLEHCSDPKT  840
QSIVMDEVLQ SVIMLAQDQY GNYVVQHVLE HGKPHERSAI IIKLIGQIVQ MSQQKFASNV  900
IEKCLSFGTP AERQALVNEM LGTTDENEPL QVMMKDQFAN YVVQKVLETC DDQQLELILN  960
RIKVHLNALK KYTYGKHIVA RVEKLVAAGV HRVFGASNVS KLLSRLPVID RGEAAATMSY  1020
EALARMEDPI YGCVAQILAL QQQVSPSDLA L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3bsb_A1e-1306489843339Pumilio homolog 1
3bsb_B1e-1306489843339Pumilio homolog 1
3bsx_A1e-1306489843339Pumilio homolog 1
3bsx_B1e-1306489843339Pumilio homolog 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010658540.10.0PREDICTED: pumilio homolog 2-like
SwissprotQ9ZW070.0PUM1_ARATH; Pumilio homolog 1
TrEMBLF6HNV50.0F6HNV5_VITVI; Putative uncharacterized protein
STRINGVIT_13s0019g02000.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58190.16e-22lateral organ boundaries-domain 29